LL37

LL-37 – 5mg Research Peptide

Human Cathelicidin Antimicrobial Peptide

For In Vitro Research Use Only – Not for Human or Animal Use

Product Overview

LL-37 is a synthetic form of the human cathelicidin antimicrobial peptide derived from the precursor protein hCAP-18. It is the only known cathelicidin identified in humans and is extensively studied in laboratory research for its involvement in innate immune defense, microbial membrane interactions, and immune-related cellular signaling pathways.

In vitro research models commonly utilize LL-37 to examine host-defense peptide mechanisms, inflammatory modulation, epithelial repair processes, and antimicrobial activity across a broad range of microorganisms. Its amphipathic and cationic structure makes it a valuable compound for studying peptide-membrane interactions and immune system signaling dynamics.

PureLabs LL-37 is supplied as a high-purity lyophilized peptide for controlled experimental applications.

Product Specifications

• Peptide: LL-37 (Human Cathelicidin)

• Quantity: 5 mg per vial

• Form: Lyophilized powder

• Sequence: [LL-37, 37 aa]

• Molecular Formula: C₂₀₃H₃₁₈N₆₀O₄₉

• Molecular Weight: ~4493.3 Da

• Solubility: Soluble in sterile water, PBS, or compatible laboratory buffers

• Storage: Store dry at 2°C–8°C, protected from light and moisture

Research Applications

LL-37 is commonly studied in vitro for:

• Antimicrobial activity modeling against bacterial, viral, and fungal organisms

• Innate immune system signaling and host-defense mechanisms

• Wound healing and epithelial cell repair pathways

• Inflammatory response modulation and cytokine signaling

• Peptide–membrane interaction studies

For Research Use Only

This product is intended exclusively for laboratory research purposes. It is not approved for human or animal use and must not be used in pharmaceuticals, dietary supplements, food products, cosmetics, or diagnostic applications.

Disclaimer

This product has not been evaluated by the U.S. Food and Drug Administration. It is not intended to diagnose, treat, cure, or prevent any disease. All information provided is for scientific and educational research purposes only.

Terms of Sale

By purchasing this product, the buyer confirms they are a qualified researcher or institutional representative and accepts full responsibility for proper handling, storage, use, and compliance with all applicable laws and regulations. All sales are final.